Protein Molecular Weight Calculator
Input Parameters
Results & Analysis
Enter parameters and click "Calculate" to see results
What is Protein Molecular Weight Calculator?
Protein molecular weight, also known as protein molar mass or protein MW, is the total mass of a protein molecule expressed in Daltons (Da) or kiloDaltons (kDa), calculated from the sum of the atomic masses of all constituent amino acids, post-translational modifications (PTMs), disulfide bonds, and oligomeric states. It is a fundamental parameter in biochemistry, proteomics, structural biology, and biopharmaceutical development, directly influencing protein purification strategies, SDS-PAGE migration, mass spectrometry identification, and therapeutic dosing calculations.
This free online protein molecular weight calculator is the most comprehensive and accurate tool available for molecular biologists, protein chemists, and biotech researchers who need to compute exact masses from sequences, estimate sizes via approximations, adjust for PTMs and disulfide bonds, predict SDS-PAGE mobility, deconvolute mass spec peaks, or calculate oligomeric masses. Whether you are designing a recombinant antibody, analyzing a novel enzyme from metagenomics, or validating a biosimilar, this calculator supports 9 professional methods in one seamless interface.
What sets this protein MW calculator apart is its laboratory-grade features: interactive relevant visualization with Chart.js comparing multiple calculation methods side-by-side, a dedicated section for comments, analysis, and recommendations that evaluates result plausibility, flags potential issues (e.g., unrealistic PTM load), and suggests validation experiments, step-by-step calculation transparency so every user can audit the arithmetic, one-click CSV export of all inputs, results, steps, and batch summaries, and a colorblind view toggle for improved accessibility—ensuring every scientist, regardless of visual ability, can collaborate effectively in shared lab environments.
In the era of high-throughput proteomics and AI-driven protein design—where even a 0.1% error in molecular weight can derail downstream applications—this free online amino acid sequence to molecular weight calculator eliminates hours of manual spreadsheet work while delivering publication-ready, traceable results.
How to use this Protein Molecular Weight Calculator
The purpose of this online protein molecular weight calculator is to convert raw protein data (sequences, counts, or experimental measurements) into precise molecular weight values across nine complementary methods, enabling cross-validation and method selection based on available data.
Input definitions (method-specific):
- Amino Acid Sequence: One-letter code (e.g., MAKAL…) for exact sequence-based calculation.
- Number of Amino Acids: For average residue approximation (quick estimate).
- Base MW + PTM Count/Type: For post-translational modification adjustments.
- Base MW + Disulfide Bonds: For covalent bond mass correction.
- Calibration Constants (a, b) + Migration/Dye Front Distances: For SDS-PAGE mobility estimation.
- m/z Value + Charge State: For single-peak mass spectrometry deconvolution.
- Two m/z Peaks: For double-peak charge-state resolution.
- Extinction Coefficient + Concentration + A280: For UV-based indirect mass calculation.
- Monomer MW + Oligomeric State (n): For multimeric protein mass.
All inputs support real-time validation, unit selection (Da/kDa/g/mol/lb/mol), and automatic formula switching.
Protein Molecular Weight Formula
Sequence-Based
\( MW = \sum (m_{aa}) – (n-1) \times 18.015 \) Where:
- \( m_{aa} \) = residue mass of each amino acid
- \( n \) = number of residues
Average Residue Approximation
\( MW \approx n \times 110 \)
PTM-Adjusted
\( MW = MW_{base} + \sum (m_{PTM} \times count) \)
Disulfide-Adjusted
\( MW = MW_{base} + n_{SS} \times (-2.016) \)
SDS-PAGE Estimation
\( \log_{10} MW = a – b \times R_f \)
MS Single Peak
\( MW = (m/z \times z) – (z \times 1.007276) \)
MS Double Peak
\( MW = \frac{(m_1 – 1.007276) \times (m_2 – 1.007276)}{m_1 – m_2} \)
Extinction Coefficient
\( MW = \frac{\epsilon \times c}{A_{280}} \)
Oligomer
\( MW = MW_{monomer} \times n \)
How to Calculate Protein Molecular Weight (Step-by-Step)
Sequence-Based Method
- Paste one-letter amino acid sequence.
- Select monoisotopic or average mass.
- System sums residue masses.
- Subtracts (n-1) water molecules for peptide bonds.
- Outputs final MW in chosen units.
Average Residue Approximation
- Enter total amino acid count.
- Multiplies by 110 Da average residue mass.
- Provides quick estimate (±10% accuracy).
PTM-Adjusted Method
- Enter base MW.
- Specify number and type of PTMs (phosphorylation, glycosylation, etc.).
- Adds cumulative PTM masses.
Disulfide Method
- Enter base MW.
- Enter number of disulfide bonds.
- Subtracts 2.016 Da per bond.
SDS-PAGE Method
- Enter calibration constants a and b.
- Enter migration distance and dye front distance.
- Computes Rf and solves log MW equation.
Mass Spectrometry Methods
- Enter m/z value(s) and charge state(s).
- Deconvolutes to neutral mass.
Extinction Coefficient Method
- Enter ε280, concentration, and measured A280.
- Computes mass from Beer-Lambert relationship.
Oligomer Method
- Enter monomer MW.
- Enter oligomeric state (dimer = 2, etc.).
Examples
Example 1 – Sequence-Based (Recombinant Insulin) Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (30 aa) Mass type: Average
Result: MW = 5,808.6 Da (5.81 kDa) Step-by-step: Sum of residues = 5,844.6 Da → minus 29 water losses = 5,808.6 Da Interpretation: Matches commercial insulin standard.
Example 2 – Oligomer + PTM (Antibody Fragment) Monomer MW = 25,000 Da, Oligomeric state = 2, 4 phosphorylations (79.97 Da each)
Result: MW = 50,319.9 Da (50.32 kDa) Step-by-step: Dimer = 50,000 Da → + 4 × 79.97 Da PTM = 50,319.9 Da Interpretation: Typical scFv dimer with regulatory phosphorylations.
Protein Molecular Weight Categories / Normal Range
| Protein Class | Typical MW Range (kDa) | Common Examples | Notes |
|---|---|---|---|
| Small peptides | 0.5 – 5 | Insulin, antimicrobial peptides | Often <50 aa |
| Single-domain proteins | 10 – 30 | GFP, lysozyme | Common recombinant tags |
| Antibodies (scFv / Fab) | 25 – 55 | Therapeutic fragments | Monomeric or dimeric |
| Full IgG antibodies | 140 – 160 | Monoclonal therapeutics | Heavily glycosylated |
| Large enzymes / complexes | 100 – 500 | Rubisco, proteasomes | Often oligomeric |
| Mega-proteins | >500 | Titin, dystrophin | Structural giants |
Limitations
- Sequence-based method assumes standard amino acids and no unknown modifications.
- Average residue approximation has ±10% error for atypical compositions.
- PTM and disulfide adjustments require accurate knowledge of modifications.
- SDS-PAGE estimates are empirical and gel-dependent.
- Mass spec methods assume correct charge-state assignment.
- Does not account for non-covalent ligands, metals, or buffer adducts.
Disclaimer
This protein molecular weight calculator is provided for research, educational, and laboratory planning purposes only. While every effort has been made to ensure mathematical accuracy and adherence to published biochemical principles, results should always be verified experimentally (e.g., by MALDI-TOF, ESI-MS, or analytical ultracentrifugation) when used for publication, regulatory submissions, or therapeutic development. clac360.com and its developers assume no liability for any direct or indirect consequences arising from the use of this tool. Always consult current literature and institutional guidelines when interpreting protein molecular weights in scientific or clinical contexts.